![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) unusual fold |
![]() | Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) ![]() |
![]() | Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) |
![]() | Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries) |
![]() | Domain d1dq9d4: 1dq9 D:453-586,D:704-865 [42596] Other proteins in same PDB: d1dq9a1, d1dq9b1, d1dq9c1, d1dq9d1 complexed with hmg |
PDB Entry: 1dq9 (more details), 2.8 Å
SCOPe Domain Sequences for d1dq9d4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dq9d4 d.179.1.1 (D:453-586,D:704-865) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} gnaekgakflsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqyl pyrdynyslvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcra iglgggassrvladXksvvceavipakvvrevlkttteamievninknlvgsamagsigg ynahaanivtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvggg tnllpqqaclqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvks
Timeline for d1dq9d4: