SCOP 1.75: Domain d1dq8d4: 1dq8 D:458-586,D:704-864

Lineage for d1dq8d4 (1dq8 D:458-586,D:704-864)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)

8. Domain d1dq8d4: 1dq8 D:458-586,D:704-864 [42592]
   Other proteins in same PDB: d1dq8a1, d1dq8b1, d1dq8c1, d1dq8d1
   complexed with coa, dtt, mah; mutant

Details for d1dq8d4

PDB Entry: 1dq8, 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa

PDB Compounds: (D:) protein (hmg-coa reductase)

SCOP Domain Sequences for d1dq8d4:

Sequence; same for both SEQRES and ATOM records:

>d1dq8d4 d.179.1.1 (D:458-586,D:704-864) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
gakflsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdy
nyslvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgg
gassrvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynaha
anivtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllp
qqaclqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvk

Timeline for d1dq8d4:

• d1dq8d4 first appeared (with stable ids) in SCOP 1.55
  
• d1dq8d4 appears in SCOP 1.73
  
• d1dq8d4 appears in SCOPe 2.01
  
• d1dq8d4 appears in the current release, SCOPe 2.08