Lineage for d1dq8d4 (1dq8 D:458-586,D:704-864)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86006Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 86007Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 86008Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 86009Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 86010Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 86022Domain d1dq8d4: 1dq8 D:458-586,D:704-864 [42592]
    Other proteins in same PDB: d1dq8a1, d1dq8b1, d1dq8c1, d1dq8d1

Details for d1dq8d4

PDB Entry: 1dq8 (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa

SCOP Domain Sequences for d1dq8d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq8d4 d.179.1.1 (D:458-586,D:704-864) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gakflsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdy
nyslvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgg
gassrvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynaha
anivtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllp
qqaclqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvk

SCOP Domain Coordinates for d1dq8d4:

Click to download the PDB-style file with coordinates for d1dq8d4.
(The format of our PDB-style files is described here.)

Timeline for d1dq8d4: