Lineage for d1dq8c4 (1dq8 C:464-586,C:704-865)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
unusual foldSuperfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) 
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries) 
Domain d1dq8c4: 1dq8 C:464-586,C:704-865 [42591]
Other proteins in same PDB: d1dq8a1, d1dq8b1, d1dq8c1, d1dq8d1
complexed with coa, dtt, mah
Details for d1dq8c4
PDB Entry: 1dq8 (more details), 2.1 Å
PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa
PDB Compounds: (C:) protein (hmg-coa reductase)SCOPe Domain Sequences for d1dq8c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dq8c4 d.179.1.1 (C:464-586,C:704-865) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
daeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynyslvm
gaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggassrv
ladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaanivta
iyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqaclq
mlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvks
SCOPe Domain Coordinates for d1dq8c4:
Click to download the PDB-style file with coordinates for d1dq8c4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dq8c4:
View in 3D
