Lineage for d1dq8c4 (1dq8 C:464-586,C:704-865)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337466Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 337467Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 337468Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 337469Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 337470Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 337481Domain d1dq8c4: 1dq8 C:464-586,C:704-865 [42591]
    Other proteins in same PDB: d1dq8a1, d1dq8b1, d1dq8c1, d1dq8d1

Details for d1dq8c4

PDB Entry: 1dq8 (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa

SCOP Domain Sequences for d1dq8c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq8c4 d.179.1.1 (C:464-586,C:704-865) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
daeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynyslvm
gaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggassrv
ladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaanivta
iyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqaclq
mlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvks

SCOP Domain Coordinates for d1dq8c4:

Click to download the PDB-style file with coordinates for d1dq8c4.
(The format of our PDB-style files is described here.)

Timeline for d1dq8c4: