SCOPe 2.08: Domain d1dq8b4: 1dq8 B:461-586,B:704-865

Lineage for d1dq8b4 (1dq8 B:461-586,B:704-865)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
   unusual fold

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)

8. Domain d1dq8b4: 1dq8 B:461-586,B:704-865 [42590]
   Other proteins in same PDB: d1dq8a1, d1dq8b1, d1dq8c1, d1dq8d1
   complexed with coa, dtt, mah

Details for d1dq8b4

PDB Entry: 1dq8, 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa

PDB Compounds: (B:) protein (hmg-coa reductase)

SCOPe Domain Sequences for d1dq8b4:

Sequence; same for both SEQRES and ATOM records:

>d1dq8b4 d.179.1.1 (B:461-586,B:704-865) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
flsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynys
lvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggas
srvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaani
vtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqa
clqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvks

Timeline for d1dq8b4:

• d1dq8b4 first appeared (with stable ids) in SCOP 1.55
  
• d1dq8b4 appears in SCOPe 2.07