Lineage for d1dqad4 (1dqa D:477-586,D:704-872)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879178Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 879179Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 879180Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 879181Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 879182Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 879186Domain d1dqad4: 1dqa D:477-586,D:704-872 [42588]
    Other proteins in same PDB: d1dqaa1, d1dqab1, d1dqac1, d1dqad1
    complexed with coa, mah, nap; mutant

Details for d1dqad4

PDB Entry: 1dqa (more details), 2 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+
PDB Compounds: (D:) protein (hmg-coa reductase)

SCOP Domain Sequences for d1dqad4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqad4 d.179.1.1 (D:477-586,D:704-872) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
paykletliethergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympi
pvgvagplcldekefqvpmattegclvastnrgcraiglgggassrvladXksvvceavi
pakvvrevlkttteamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnv
gssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpg
enarqlarivcgtvmagelslmaalaaghlvkshmihnrs

SCOP Domain Coordinates for d1dqad4:

Click to download the PDB-style file with coordinates for d1dqad4.
(The format of our PDB-style files is described here.)

Timeline for d1dqad4: