Lineage for d1dqad4 (1dqa D:477-586,D:704-872)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) 
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries) 
Domain d1dqad4: 1dqa D:477-586,D:704-872 [42588]
Other proteins in same PDB: d1dqaa1, d1dqab1, d1dqac1, d1dqad1
Details for d1dqad4
PDB Entry: 1dqa (more details), 2 Å
PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+
SCOP Domain Sequences for d1dqad4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqad4 d.179.1.1 (D:477-586,D:704-872) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
paykletliethergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympi
pvgvagplcldekefqvpmattegclvastnrgcraiglgggassrvladXksvvceavi
pakvvrevlkttteamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnv
gssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpg
enarqlarivcgtvmagelslmaalaaghlvkshmihnrs
SCOP Domain Coordinates for d1dqad4:
Click to download the PDB-style file with coordinates for d1dqad4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dqad4:
View in 3D
