Lineage for d1dqad4 (1dqa D:477-586,D:704-872)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37690Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 37691Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 37692Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 37693Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 37694Species Human (Homo sapiens) [TaxId:9606] [56545] (3 PDB entries)
  8. 37698Domain d1dqad4: 1dqa D:477-586,D:704-872 [42588]
    Other proteins in same PDB: d1dqaa1, d1dqab1, d1dqac1, d1dqad1

Details for d1dqad4

PDB Entry: 1dqa (more details), 2 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+

SCOP Domain Sequences for d1dqad4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqad4 d.179.1.1 (D:477-586,D:704-872) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
paykletliethergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympi
pvgvagplcldekefqvpmattegclvastnrgcraiglgggassrvladXksvvceavi
pakvvrevlkttteamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnv
gssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpg
enarqlarivcgtvmagelslmaalaaghlvkshmihnrs

SCOP Domain Coordinates for d1dqad4:

Click to download the PDB-style file with coordinates for d1dqad4.
(The format of our PDB-style files is described here.)

Timeline for d1dqad4: