SCOP 1.55: Domain d1dqab4: 1dqa B:462-586,B:704-866

Lineage for d1dqab4 (1dqa B:462-586,B:704-866)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)

4. Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family)

5. Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)

6. Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56545] (3 PDB entries)

8. Domain d1dqab4: 1dqa B:462-586,B:704-866 [42586]
   Other proteins in same PDB: d1dqaa1, d1dqab1, d1dqac1, d1dqad1

Details for d1dqab4

PDB Entry: 1dqa, 2 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+

SCOP Domain Sequences for d1dqab4:

Sequence; same for both SEQRES and ATOM records:

>d1dqab4 d.179.1.1 (B:462-586,B:704-866) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
lsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynysl
vmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggass
rvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaaniv
taiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqac
lqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvksh

Timeline for d1dqab4:

• d1dqab4 appears in SCOP 1.57
  
• d1dqab4 appears in the current release, SCOPe 2.08