Lineage for d1dqaa4 (1dqa A:462-586,A:704-870)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139893Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 139894Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 139895Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 139896Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 139897Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 139898Domain d1dqaa4: 1dqa A:462-586,A:704-870 [42585]
    Other proteins in same PDB: d1dqaa1, d1dqab1, d1dqac1, d1dqad1

Details for d1dqaa4

PDB Entry: 1dqa (more details), 2 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+

SCOP Domain Sequences for d1dqaa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqaa4 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
lsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynysl
vmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggass
rvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaaniv
taiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqac
lqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvkshmihn

SCOP Domain Coordinates for d1dqaa4:

Click to download the PDB-style file with coordinates for d1dqaa4.
(The format of our PDB-style files is described here.)

Timeline for d1dqaa4: