Lineage for d1dmwa_ (1dmw A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56539] (16 PDB entries)
    Uniprot P00439 117-424
  8. Domain d1dmwa_: 1dmw A: [42580]
    complexed with fe, hbi

Details for d1dmwa_

PDB Entry: 1dmw (more details), 2 Å

PDB Description: crystal structure of double truncated human phenylalanine hydroxylase with bound 7,8-dihydro-l-biopterin
PDB Compounds: (A:) phenylalanine hydroxylase

SCOPe Domain Sequences for d1dmwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmwa_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]}
vpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprv
eymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtc
tgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdr
sfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyc
lsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpy
tqrievl

SCOPe Domain Coordinates for d1dmwa_ are not available.

Timeline for d1dmwa_: