Lineage for d6pah__ (6pah -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337435Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 337436Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 337437Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins)
  6. 337438Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 337443Species Human (Homo sapiens) [TaxId:9606] [56539] (11 PDB entries)
  8. 337451Domain d6pah__: 6pah - [42579]
    complexed with fe

Details for d6pah__

PDB Entry: 6pah (more details), 2.15 Å

PDB Description: human phenylalanine hydroxylase catalytic domain dimer with bound l-dopa (3,4-dihydroxyphenylalanine) inhibitor

SCOP Domain Sequences for d6pah__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pah__ d.178.1.1 (-) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOP Domain Coordinates for d6pah__:

Click to download the PDB-style file with coordinates for d6pah__.
(The format of our PDB-style files is described here.)

Timeline for d6pah__: