Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily) unusual fold |
Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) |
Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins) |
Protein Phenylalanine hydroxylase, PAH [56538] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56539] (16 PDB entries) Uniprot P00439 117-424 |
Domain d1paha_: 1pah A: [42578] complexed with fe |
PDB Entry: 1pah (more details), 2 Å
SCOPe Domain Sequences for d1paha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1paha_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]} tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp ytqrievl
Timeline for d1paha_: