Lineage for d4pah__ (4pah -)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
unusual foldSuperfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) 
Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins) Protein Phenylalanine hydroxylase, PAH [56538] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [56539] (13 PDB entries) 
Domain d4pah__: 4pah - [42576]
complexed with fe, nar
Details for d4pah__
PDB Entry: 4pah (more details), 2 Å
PDB Description: human phenylalanine hydroxylase catalytic domain dimer with bound nor-adrenaline inhibitor
SCOP Domain Sequences for d4pah__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pah__ d.178.1.1 (-) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl
SCOP Domain Coordinates for d4pah__:
Click to download the PDB-style file with coordinates for d4pah__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4pah__:
- d4pah__ first appeared (with stable ids) in SCOP 1.55
- d4pah__ appears in SCOP 1.65
- d4pah__ appears in SCOP 1.69
- d4pah__ appears in the current release, SCOPe 2.08, called d4paha_
View in 3D