Lineage for d4pah__ (4pah -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37670Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
  4. 37671Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 37672Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (2 proteins)
  6. 37673Protein Phenylalanine hydroxylase [56538] (2 species)
  7. 37674Species Human (Homo sapiens) [TaxId:9606] [56539] (7 PDB entries)
  8. 37676Domain d4pah__: 4pah - [42576]

Details for d4pah__

PDB Entry: 4pah (more details), 2 Å

PDB Description: human phenylalanine hydroxylase catalytic domain dimer with bound nor-adrenaline inhibitor

SCOP Domain Sequences for d4pah__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pah__ d.178.1.1 (-) Phenylalanine hydroxylase {Human (Homo sapiens)}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOP Domain Coordinates for d4pah__:

Click to download the PDB-style file with coordinates for d4pah__.
(The format of our PDB-style files is described here.)

Timeline for d4pah__: