Lineage for d4paha_ (4pah A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004816Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 3004817Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 3004818Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 3004819Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 3004834Species Human (Homo sapiens) [TaxId:9606] [56539] (16 PDB entries)
    Uniprot P00439 117-424
  8. 3004838Domain d4paha_: 4pah A: [42576]
    complexed with fe, lnr

Details for d4paha_

PDB Entry: 4pah (more details), 2 Å

PDB Description: human phenylalanine hydroxylase catalytic domain dimer with bound nor-adrenaline inhibitor
PDB Compounds: (A:) phenylalanine hydroxylase

SCOPe Domain Sequences for d4paha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4paha_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOPe Domain Coordinates for d4paha_:

Click to download the PDB-style file with coordinates for d4paha_.
(The format of our PDB-style files is described here.)

Timeline for d4paha_: