Lineage for d3pah__ (3pah -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265091Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 265092Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 265093Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins)
  6. 265094Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 265099Species Human (Homo sapiens) [TaxId:9606] [56539] (11 PDB entries)
  8. 265102Domain d3pah__: 3pah - [42575]
    complexed with ale, fe

Details for d3pah__

PDB Entry: 3pah (more details), 2 Å

PDB Description: human phenylalanine hydroxylase catalytic domain dimer with bound adrenaline inhibitor

SCOP Domain Sequences for d3pah__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pah__ d.178.1.1 (-) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOP Domain Coordinates for d3pah__:

Click to download the PDB-style file with coordinates for d3pah__.
(The format of our PDB-style files is described here.)

Timeline for d3pah__: