Lineage for d1soxb3 (1sox B:94-343)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738846Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 738847Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (1 family) (S)
  5. 738848Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins)
    Pfam PF00174
  6. 738866Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)
  7. 738867Species Chicken (Gallus gallus) [TaxId:9031] [56527] (5 PDB entries)
  8. 738870Domain d1soxb3: 1sox B:94-343 [42564]
    Other proteins in same PDB: d1soxa1, d1soxa2, d1soxb1, d1soxb2
    complexed with epe, gol, hem, mo, mte, so4

Details for d1soxb3

PDB Entry: 1sox (more details), 1.9 Å

PDB Description: sulfite oxidase from chicken liver
PDB Compounds: (B:) sulfite oxidase

SCOP Domain Sequences for d1soxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soxb3 d.176.1.1 (B:94-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus) [TaxId: 9031]}
qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
rvdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistar
wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt
vdyrtapaiq

SCOP Domain Coordinates for d1soxb3:

Click to download the PDB-style file with coordinates for d1soxb3.
(The format of our PDB-style files is described here.)

Timeline for d1soxb3: