SCOP 1.69: Domain d1soxb3: 1sox B:94-343

Lineage for d1soxb3 (1sox B:94-343)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.176: Sulfite oxidase, middle catalytic domain [56523] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif

4. Superfamily d.176.1: Sulfite oxidase, middle catalytic domain [56524] (1 family)

5. Family d.176.1.1: Sulfite oxidase, middle catalytic domain [56525] (1 protein)

6. Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56527] (1 PDB entry)

8. Domain d1soxb3: 1sox B:94-343 [42564]
   Other proteins in same PDB: d1soxa1, d1soxa2, d1soxb1, d1soxb2

Details for d1soxb3

PDB Entry: 1sox, 1.9 Å

PDB Description: sulfite oxidase from chicken liver

SCOP Domain Sequences for d1soxb3:

Sequence; same for both SEQRES and ATOM records:

>d1soxb3 d.176.1.1 (B:94-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus)}
qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
rvdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistar
wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt
vdyrtapaiq

Timeline for d1soxb3:

• d1soxb3 first appeared (with stable ids) in SCOP 1.55
  
• d1soxb3 appears in SCOP 1.67
  
• d1soxb3 appears in SCOP 1.71
  
• d1soxb3 appears in the current release, SCOPe 2.08