Lineage for d1soxb3 (1sox B:94-343)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199258Fold d.176: Sulfite oxidase, middle catalytic domain [56523] (1 superfamily)
  4. 199259Superfamily d.176.1: Sulfite oxidase, middle catalytic domain [56524] (1 family) (S)
  5. 199260Family d.176.1.1: Sulfite oxidase, middle catalytic domain [56525] (1 protein)
  6. 199261Protein Sulfite oxidase, middle catalytic domain [56526] (1 species)
  7. 199262Species Chicken (Gallus gallus) [TaxId:9031] [56527] (1 PDB entry)
  8. 199264Domain d1soxb3: 1sox B:94-343 [42564]
    Other proteins in same PDB: d1soxa1, d1soxa2, d1soxb1, d1soxb2

Details for d1soxb3

PDB Entry: 1sox (more details), 1.9 Å

PDB Description: sulfite oxidase from chicken liver

SCOP Domain Sequences for d1soxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soxb3 d.176.1.1 (B:94-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus)}
qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
rvdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistar
wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt
vdyrtapaiq

SCOP Domain Coordinates for d1soxb3:

Click to download the PDB-style file with coordinates for d1soxb3.
(The format of our PDB-style files is described here.)

Timeline for d1soxb3: