| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() |
| Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains) |
| Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
| Species Cow (Bos taurus) [TaxId:9913] [56517] (43 PDB entries) Uniprot P29473 67-482 |
| Domain d9nseb_: 9nse B: [42555] complexed with act, cad, gol, h4b, hem, isu, zn |
| PDB Entry: 9nse (more details) PDB Description: bovine endothelial nitric oxide synthase, ethyl-isoselenoure
PDB Compounds: (B:) protein (nitric oxide synthase)SCOP Domain Sequences for d9nseb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d9nseb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw
SCOP Domain Coordinates for d9nseb_:
Click to download the PDB-style file with coordinates for d9nseb_. (The format of our PDB-style files is described here.)
Timeline for d9nseb_:
d9nseb_ appears in SCOP 1.75A | d9nseb_ (click for larger image) d9nseb_ in context of chain d9nseb_ in context of PDB Domains from other chains: d9nsea_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |