SCOPe 2.04: Domain d1ed6b_: 1ed6 B:

Lineage for d1ed6b_ (1ed6 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (85 PDB entries)
   Uniprot P29473 67-482

8. Domain d1ed6b_: 1ed6 B: [42553]
   complexed with act, cad, gol, hem, ilo, zn

Details for d1ed6b_

PDB Entry: 1ed6, 2.05 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with l-nio (h4b free)

PDB Compounds: (B:) nitric oxide synthase

SCOPe Domain Sequences for d1ed6b_:

Sequence; same for both SEQRES and ATOM records:

>d1ed6b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1ed6b_:

• d1ed6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ed6b_ appears in SCOPe 2.03
  
• d1ed6b_ appears in SCOPe 2.05
  
• d1ed6b_ appears in the current release, SCOPe 2.08