Lineage for d1dm7b_ (1dm7 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2609059Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2609067Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
    Uniprot P29473 67-482
  8. 2609131Domain d1dm7b_: 1dm7 B: [42549]
    complexed with act, cac, gol, hem, hrg, zn

Details for d1dm7b_

PDB Entry: 1dm7 (more details), 2.1 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with homoarginine (h4b free)
PDB Compounds: (B:) nitric oxide synthase

SCOPe Domain Sequences for d1dm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm7b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1dm7b_:

Click to download the PDB-style file with coordinates for d1dm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1dm7b_: