Lineage for d1dm7b_ (1dm7 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
    Uniprot P29473 67-482
  8. Domain d1dm7b_: 1dm7 B: [42549]
    complexed with act, cac, gol, hem, hrg, zn

Details for d1dm7b_

PDB Entry: 1dm7 (more details), 2.1 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with homoarginine (h4b free)
PDB Compounds: (B:) nitric oxide synthase

SCOPe Domain Sequences for d1dm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm7b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1dm7b_ are not available.

Timeline for d1dm7b_:

Domains from other chains:
(mouse over for more information)
d1dm7a_