Lineage for d1dm7a_ (1dm7 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560335Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2560336Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2560337Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2560338Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2560346Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
    Uniprot P29473 67-482
  8. 2560409Domain d1dm7a_: 1dm7 A: [42548]
    complexed with act, cac, gol, hem, hrg, zn

Details for d1dm7a_

PDB Entry: 1dm7 (more details), 2.1 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with homoarginine (h4b free)
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d1dm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm7a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1dm7a_:

Click to download the PDB-style file with coordinates for d1dm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1dm7a_: