Lineage for d1dm6b_ (1dm6 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37571Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
  4. 37572Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 37573Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 37574Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)
  7. 37575Species Cow (Bos taurus) [TaxId:9913] [56517] (15 PDB entries)
  8. 37587Domain d1dm6b_: 1dm6 B: [42543]

Details for d1dm6b_

PDB Entry: 1dm6 (more details), 1.95 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with n-(4-chlorophenyl)-n'-hydroxyguanidine (h4b free)

SCOP Domain Sequences for d1dm6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm6b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1dm6b_:

Click to download the PDB-style file with coordinates for d1dm6b_.
(The format of our PDB-style files is described here.)

Timeline for d1dm6b_: