SCOP 1.57: Domain d1dm6a_: 1dm6 A:

Lineage for d1dm6a_ (1dm6 A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (23 PDB entries)

8. Domain d1dm6a_: 1dm6 A: [42542]

Details for d1dm6a_

PDB Entry: 1dm6, 1.95 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with n-(4-chlorophenyl)-n'-hydroxyguanidine (h4b free)

SCOP Domain Sequences for d1dm6a_:

Sequence; same for both SEQRES and ATOM records:

>d1dm6a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1dm6a_:

• d1dm6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dm6a_ appears in SCOP 1.59
  
• d1dm6a_ appears in the current release, SCOPe 2.08