SCOP 1.73: Domain d1d1wb_: 1d1w B:

Lineage for d1d1wb_ (1d1w B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (39 PDB entries)

8. Domain d1d1wb_: 1d1w B: [42539]
   complexed with act, atq, bh4, cad, gol, hem, zn

Details for d1d1wb_

PDB Entry: 1d1w, 2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 2-aminothiazoline (h4b bound)

PDB Compounds: (B:) nitric oxide synthase

SCOP Domain Sequences for d1d1wb_:

Sequence; same for both SEQRES and ATOM records:

>d1d1wb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1d1wb_:

• d1d1wb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1wb_ appears in SCOP 1.71
  
• d1d1wb_ appears in SCOP 1.75
  
• d1d1wb_ appears in the current release, SCOPe 2.08