Lineage for d1nseb_ (1nse B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) 
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein) Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species) Species Cow (Bos taurus) [TaxId:9913] [56517] (15 PDB entries) 
Domain d1nseb_: 1nse B: [42535]
Details for d1nseb_
PDB Entry: 1nse (more details), 1.9 Å
PDB Description: bovine endothelial nitric oxide synthase
SCOP Domain Sequences for d1nseb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nseb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw
SCOP Domain Coordinates for d1nseb_:
Click to download the PDB-style file with coordinates for d1nseb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nseb_:
- d1nseb_ appears in SCOP 1.57
- d1nseb_ appears in the current release, SCOPe 2.08
View in 3D
