SCOPe 2.06: Domain d1nsea_: 1nse A:

Lineage for d1nsea_ (1nse A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries)
   Uniprot P29473 67-482

8. Domain d1nsea_: 1nse A: [42534]
   complexed with act, cac, gol, h4b, hem, itu, zn

Details for d1nsea_

PDB Entry: 1nse, 1.9 Å

PDB Description: bovine endothelial nitric oxide synthase

PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d1nsea_:

Sequence; same for both SEQRES and ATOM records:

>d1nsea_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1nsea_:

• d1nsea_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsea_ appears in SCOPe 2.05
  
• d1nsea_ appears in SCOPe 2.07
  
• d1nsea_ appears in the current release, SCOPe 2.08