Lineage for d1ed5b_ (1ed5 B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421842Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 421843Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 421844Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 421845Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 421849Species Cow (Bos taurus) [TaxId:9913] [56517] (34 PDB entries)
  8. 421855Domain d1ed5b_: 1ed5 B: [42531]
    complexed with act, cad, gol, hem, nrg, zn

Details for d1ed5b_

PDB Entry: 1ed5 (more details), 1.8 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with nna(h4b free)

SCOP Domain Sequences for d1ed5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed5b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1ed5b_:

Click to download the PDB-style file with coordinates for d1ed5b_.
(The format of our PDB-style files is described here.)

Timeline for d1ed5b_: