Lineage for d1ed5a_ (1ed5 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049000Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1049001Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 1049002Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1049003Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1049011Species Cow (Bos taurus) [TaxId:9913] [56517] (43 PDB entries)
    Uniprot P29473 67-482
  8. 1049018Domain d1ed5a_: 1ed5 A: [42530]
    complexed with act, cad, gol, hem, nrg, zn

Details for d1ed5a_

PDB Entry: 1ed5 (more details), 1.8 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with nna(h4b free)
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d1ed5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed5a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1ed5a_:

Click to download the PDB-style file with coordinates for d1ed5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ed5a_: