Lineage for d2nsib_ (2nsi B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878765Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 878766Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 878767Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 878768Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 878854Species Human (Homo sapiens) [TaxId:9606] [56516] (11 PDB entries)
  8. 878882Domain d2nsib_: 2nsi B: [42527]

Details for d2nsib_

PDB Entry: 2nsi (more details), 3 Å

PDB Description: human inducible nitric oxide synthase, zn-free, seitu complex
PDB Compounds: (B:) protein (nitric oxide synthase)

SCOP Domain Sequences for d2nsib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nsib_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq

SCOP Domain Coordinates for d2nsib_:

Click to download the PDB-style file with coordinates for d2nsib_.
(The format of our PDB-style files is described here.)

Timeline for d2nsib_: