Lineage for d1nsid_ (1nsi D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941879Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1941880Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1941881Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1941882Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1942061Species Human (Homo sapiens) [TaxId:9606] [56516] (10 PDB entries)
  8. 1942083Domain d1nsid_: 1nsi D: [42525]
    complexed with arg, gol, h4b, hem, so4, zn

Details for d1nsid_

PDB Entry: 1nsi (more details), 2.55 Å

PDB Description: human inducible nitric oxide synthase, zn-bound, l-arg complex
PDB Compounds: (D:) protein (nitric oxide synthase)

SCOPe Domain Sequences for d1nsid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsid_ d.174.1.1 (D:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq

SCOPe Domain Coordinates for d1nsid_:

Click to download the PDB-style file with coordinates for d1nsid_.
(The format of our PDB-style files is described here.)

Timeline for d1nsid_: