SCOPe 2.04: Domain d1nsib_: 1nsi B:

Lineage for d1nsib_ (1nsi B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56516] (10 PDB entries)

8. Domain d1nsib_: 1nsi B: [42523]
   complexed with arg, gol, h4b, hem, so4, zn

Details for d1nsib_

PDB Entry: 1nsi, 2.55 Å

PDB Description: human inducible nitric oxide synthase, zn-bound, l-arg complex

PDB Compounds: (B:) protein (nitric oxide synthase)

SCOPe Domain Sequences for d1nsib_:

Sequence; same for both SEQRES and ATOM records:

>d1nsib_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq

Timeline for d1nsib_:

• d1nsib_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsib_ appears in SCOPe 2.03
  
• d1nsib_ appears in SCOPe 2.05
  
• d1nsib_ appears in the current release, SCOPe 2.08