Lineage for d1nsia_ (1nsi A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37571Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
  4. 37572Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 37573Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 37574Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)
  7. 37606Species Human (Homo sapiens) [TaxId:9606] [56516] (4 PDB entries)
  8. 37613Domain d1nsia_: 1nsi A: [42522]

Details for d1nsia_

PDB Entry: 1nsi (more details), 2.55 Å

PDB Description: human inducible nitric oxide synthase, zn-bound, l-arg complex

SCOP Domain Sequences for d1nsia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsia_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens)}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq

SCOP Domain Coordinates for d1nsia_:

Click to download the PDB-style file with coordinates for d1nsia_.
(The format of our PDB-style files is described here.)

Timeline for d1nsia_: