SCOPe 2.08: Domain d1qomb_: 1qom B:

Lineage for d1qomb_ (1qom B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
   Uniprot P29477 77-496 ! Uniprot P29477 77-495

8. Domain d1qomb_: 1qom B: [42515]
   complexed with h4b, hem

Details for d1qomb_

PDB Entry: 1qom, 2.7 Å

PDB Description: murine inducible nitric oxide synthase oxygenase dimer (delta 65) with swapped n-terminal hook

PDB Compounds: (B:) nitric oxide synthase

SCOPe Domain Sequences for d1qomb_:

Sequence; same for both SEQRES and ATOM records:

>d1qomb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

Timeline for d1qomb_:

• d1qomb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qomb_ appears in SCOPe 2.07