Lineage for d1noca_ (1noc A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37571Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
  4. 37572Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 37573Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 37574Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)
  7. 37621Species Mouse (Mus musculus) [TaxId:10090] [56515] (12 PDB entries)
  8. 37631Domain d1noca_: 1noc A: [42505]
    Other proteins in same PDB: d1nocb_

Details for d1noca_

PDB Entry: 1noc (more details), 2.6 Å

PDB Description: murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type i e. coli chloramphenicol acetyl transferase and imidazole

SCOP Domain Sequences for d1noca_:

Sequence, based on SEQRES records: (download)

>d1noca_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus)}
pksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyql
tldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnir
saitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygr
fdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgg
lefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinva
vlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqeml
nyvlspfyyyqiepwkthiwq

Sequence, based on observed residues (ATOM records): (download)

>d1noca_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus)}
pksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyql
tldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnir
saitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygr
fdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgg
lefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinva
vlhsfqkqnvtimdhhtasesfmkhmqneyrarlvppvsgsitpvfhqemlnyvlspfyy
yqiepwkthiwq

SCOP Domain Coordinates for d1noca_:

Click to download the PDB-style file with coordinates for d1noca_.
(The format of our PDB-style files is described here.)

Timeline for d1noca_: