Lineage for d1noca_ (1noc A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560335Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2560336Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2560337Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2560338Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2560590Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 2560623Domain d1noca_: 1noc A: [42505]
    Other proteins in same PDB: d1nocb_
    complexed with hem, imd

Details for d1noca_

PDB Entry: 1noc (more details), 2.6 Å

PDB Description: murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type i e. coli chloramphenicol acetyl transferase and imidazole
PDB Compounds: (A:) inducible nitric oxide synthase

SCOPe Domain Sequences for d1noca_:

Sequence, based on SEQRES records: (download)

>d1noca_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
pksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyql
tldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnir
saitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygr
fdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgg
lefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinva
vlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqeml
nyvlspfyyyqiepwkthiwq

Sequence, based on observed residues (ATOM records): (download)

>d1noca_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
pksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyql
tldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnir
saitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygr
fdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgg
lefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinva
vlhsfqkqnvtimdhhtasesfmkhmqneyrarlvppvsgsitpvfhqemlnyvlspfyy
yqiepwkthiwq

SCOPe Domain Coordinates for d1noca_:

Click to download the PDB-style file with coordinates for d1noca_.
(The format of our PDB-style files is described here.)

Timeline for d1noca_: