SCOPe 2.07: Domain d1dwwb_: 1dww B:

Lineage for d1dwwb_ (1dww B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
   Uniprot P29477 77-496 ! Uniprot P29477 77-495

8. Domain d1dwwb_: 1dww B: [42504]
   complexed with h2b, har, hem, so4, zn

Details for d1dwwb_

PDB Entry: 1dww, 2.35 Å

PDB Description: murine inducible nitric oxide synthase oxygenase dimer n-hydroxyarginine and dihydrobiopterin

PDB Compounds: (B:) nitric oxide synthase

SCOPe Domain Sequences for d1dwwb_:

Sequence; same for both SEQRES and ATOM records:

>d1dwwb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

Timeline for d1dwwb_:

• d1dwwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dwwb_ appears in SCOPe 2.06
  
• d1dwwb_ appears in the current release, SCOPe 2.08