Lineage for d1dwva_ (1dwv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3003151Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 3003465Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 3003493Domain d1dwva_: 1dwv A: [42501]
    complexed with 4ab, har, hem, so4, zn

Details for d1dwva_

PDB Entry: 1dwv (more details), 2.35 Å

PDB Description: murine inducible nitric oxide synthase oxygenase dimer n-hydroxyarginine and 4-amino tetrahydrobiopterin
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d1dwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwva_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq

SCOPe Domain Coordinates for d1dwva_:

Click to download the PDB-style file with coordinates for d1dwva_.
(The format of our PDB-style files is described here.)

Timeline for d1dwva_: