Lineage for d1nosa1 (1nos A:115-498)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560335Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2560336Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2560337Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2560338Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2560590Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 2560599Domain d1nosa1: 1nos A:115-498 [42496]
    Other proteins in same PDB: d1nosa2
    complexed with hem, imd

Details for d1nosa1

PDB Entry: 1nos (more details), 2.1 Å

PDB Description: murine inducible nitric oxide synthase oxygenase domain (delta 114), imidazole complex
PDB Compounds: (A:) inducible nitric oxide synthase

SCOPe Domain Sequences for d1nosa1:

Sequence, based on SEQRES records: (download)

>d1nosa1 d.174.1.1 (A:115-498) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
npksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyq
ltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngni
rsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkpryg
rfdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevg
glefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinv
avlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqem
lnyvlspfyyyqiepwkthiwqne

Sequence, based on observed residues (ATOM records): (download)

>d1nosa1 d.174.1.1 (A:115-498) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
npksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyq
ltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngni
rsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkpryg
rfdvlplvlqadgqdpevfeippdlvlevtmelglkwyalpavanmllevgglefpacpf
ngwymgteigvrdfcdtqdravteinvavlhsfqkqnvtimdhhtasesfmkhmqneyvl
spfyyyqiepwkthiwqne

SCOPe Domain Coordinates for d1nosa1:

Click to download the PDB-style file with coordinates for d1nosa1.
(The format of our PDB-style files is described here.)

Timeline for d1nosa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nosa2