![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.172: gp120 core [56501] (1 superfamily) unusual fold |
![]() | Superfamily d.172.1: gp120 core [56502] (1 family) ![]() |
![]() | Family d.172.1.1: gp120 core [56503] (1 protein) |
![]() | Protein gp120 core [56504] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (5 PDB entries) |
![]() | Domain d1g9ng_: 1g9n G: [42494] Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2 complexed with nag; mutant |
PDB Entry: 1g9n (more details), 2.9 Å
SCOP Domain Sequences for d1g9ng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ng_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1} lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky kvvkie
Timeline for d1g9ng_: