Lineage for d1g9mg_ (1g9m G:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878722Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 878723Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 878724Family d.172.1.1: gp120 core [56503] (1 protein)
  6. 878725Protein gp120 core [56504] (1 species)
  7. 878726Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (20 PDB entries)
  8. 878742Domain d1g9mg_: 1g9m G: [42492]
    Other proteins in same PDB: d1g9mc1, d1g9mc2, d1g9mh1, d1g9mh2, d1g9ml1, d1g9ml2
    complexed with fuc, ioh, nag; mutant

Details for d1g9mg_

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (G:) envelope glycoprotein gp120

SCOP Domain Sequences for d1g9mg_:

Sequence, based on SEQRES records: (download)

>d1g9mg_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvstqlllngsla
eeevvirsvnftdnaktiivqlntsveinctgaghcnisrakwnntlkqiasklreqfgn
nktiifkqssggdpeivthsfncggeffycnstqlfnstwfnstwstegsnntegsdtit
lpcrikqiinmwqkvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdm
rdnwrselykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d1g9mg_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
evvlvnvtenfnmwkndmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcnnktfngtgpctnvstvqcthgirpvvstqlllngsla
eeevvirsvnftdnaktiivqlntsveinctgaghcnisrakwnntlkqiasklreqfgn
nktiifkqssggdpeivthsfncggeffycnstqlfnstwfngsdtitlpcrikqiinmw
qkvgkamyappisgqircssnitgllltrdggnsnneseifrpgggdmrdnwrselykyk
vvkie

SCOP Domain Coordinates for d1g9mg_:

Click to download the PDB-style file with coordinates for d1g9mg_.
(The format of our PDB-style files is described here.)

Timeline for d1g9mg_: