Lineage for d1fzdd_ (1fzd D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002836Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 3002837Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 3002873Species Human (Homo sapiens), fibrinogen-420, alpha-E [TaxId:9606] [56500] (1 PDB entry)
  8. 3002877Domain d1fzdd_: 1fzd D: [42487]
    complexed with ca, nag

Details for d1fzdd_

PDB Entry: 1fzd (more details), 2.1 Å

PDB Description: structure of recombinant alphaec domain from human fibrinogen-420
PDB Compounds: (D:) fibrinogen-420

SCOPe Domain Sequences for d1fzdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzdd_ d.171.1.1 (D:) Fibrinogen C-terminal domains {Human (Homo sapiens), fibrinogen-420, alpha-E [TaxId: 9606]}
ggwlliqqrmdgslnfnrtwqdykrgfgslndegegefwlgndylhlltqrgsvlrvele
dwagneayaeyhfrvgseaegyalqvssyegtagdaliegsveegaeytshnnmqfstfd
rdadqweencaevygggwwynncqaanlngiyypggsydprnnspyeiengvvwvsfrga
dyslravrmkirplvtq

SCOPe Domain Coordinates for d1fzdd_:

Click to download the PDB-style file with coordinates for d1fzdd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzdd_: