Lineage for d1fzbc1 (1fzb C:142-396)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
unusual foldSuperfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) 
Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins) Protein Fibrinogen C-terminal domains [56498] (7 species) Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (17 PDB entries) 
Domain d1fzbc1: 1fzb C:142-396 [42473]
Other proteins in same PDB: d1fzba_, d1fzbb2, d1fzbc2, d1fzbd_, d1fzbe2, d1fzbf2
Details for d1fzbc1
PDB Entry: 1fzb (more details), 2.9 Å
PDB Description: crystal structure of crosslinked fragment d
SCOP Domain Sequences for d1fzbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzbc1 d.171.1.1 (C:142-396) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltige
SCOP Domain Coordinates for d1fzbc1:
Click to download the PDB-style file with coordinates for d1fzbc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fzbc1:
- d1fzbc1 first appeared (with stable ids) in SCOP 1.55
- d1fzbc1 appears in SCOP 1.65
- d1fzbc1 appears in SCOP 1.69
- d1fzbc1 appears in the current release, SCOPe 2.08
View in 3D
