Lineage for d1fzfc1 (1fzf C:142-393)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941620Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 1941621Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 1941622Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 1941623Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 1941668Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 1941683Domain d1fzfc1: 1fzf C:142-393 [42465]
    Other proteins in same PDB: d1fzfa_, d1fzfb2, d1fzfc2, d1fzfd_, d1fzfe2, d1fzff2
    complexed with ca, nag

Details for d1fzfc1

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (C:) fibrinogen

SCOPe Domain Sequences for d1fzfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzfc1 d.171.1.1 (C:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

SCOPe Domain Coordinates for d1fzfc1:

Click to download the PDB-style file with coordinates for d1fzfc1.
(The format of our PDB-style files is described here.)

Timeline for d1fzfc1: