Lineage for d1by2a_ (1by2 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608706Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2608707Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 2608708Family d.170.1.1: Scavenger receptor cysteine-rich (SRCR) domain [56488] (1 protein)
    has some structural similarity to the long-chain scorpion toxins
    automatically mapped to Pfam PF00530
  6. 2608709Protein M2BP [56489] (1 species)
  7. 2608710Species Human (Homo sapiens) [TaxId:9606] [56490] (1 PDB entry)
  8. 2608711Domain d1by2a_: 1by2 A: [42452]
    complexed with nag

Details for d1by2a_

PDB Entry: 1by2 (more details), 2 Å

PDB Description: structure of m2bp scavenger receptor cysteine-rich domain
PDB Compounds: (A:) mac-2 binding protein

SCOPe Domain Sequences for d1by2a_:

Sequence, based on SEQRES records: (download)

>d1by2a_ d.170.1.1 (A:) M2BP {Human (Homo sapiens) [TaxId: 9606]}
avndgdmrladggatnqgrveifyrgqwgtvcdnlwdltdasvvcralgfenatqalgra
afgqgsgpimldevqctgteasladckslgwlksncrherdagvvctnetrsthtl

Sequence, based on observed residues (ATOM records): (download)

>d1by2a_ d.170.1.1 (A:) M2BP {Human (Homo sapiens) [TaxId: 9606]}
avndgdmrladggatnqgrveifyrgqwgtvcdnlwdltdasvvcralgfenatqalgra
afgqgsgpimldevqctgteasladckslgwlksncrherdagvvctnettl

SCOPe Domain Coordinates for d1by2a_:

Click to download the PDB-style file with coordinates for d1by2a_.
(The format of our PDB-style files is described here.)

Timeline for d1by2a_: