Lineage for d1dy0a_ (1dy0 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37488Family d.169.1.5: Endostatin [56480] (2 proteins)
  6. 37489Protein Endostatin [56481] (2 species)
  7. 37495Species Mouse (Mus musculus) [TaxId:10090] [56483] (3 PDB entries)
  8. 37497Domain d1dy0a_: 1dy0 A: [42449]

Details for d1dy0a_

PDB Entry: 1dy0 (more details), 2.2 Å

PDB Description: murine endostatin, crystal form ii

SCOP Domain Sequences for d1dy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dy0a_ d.169.1.5 (A:) Endostatin {Mouse (Mus musculus)}
ahthqdfqpvlhlvalntplsggmrgirgadfqcfqqaravglsgtfraflssrlqdlys
ivrradrgsvpivnlkdevlspswdslfsgsqgqlqpgarifsfdgrdvlrhpawpqksv
whgsdpsgrrlmesycetwrtettgatgqassllsgrlleqkaaschnsyivlciensfm

SCOP Domain Coordinates for d1dy0a_:

Click to download the PDB-style file with coordinates for d1dy0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dy0a_: